ZCCHC12,FLJ16123
  • ZCCHC12,FLJ16123

Anti-ZCCHC12 Antibody 100ul

Ref: AN-HPA031016-100ul
Anti-ZCCHC12

Información del producto

Polyclonal Antibody against Human ZCCHC12, Gene description: zinc finger, CCHC domain containing 12, Alternative Gene Names: FLJ16123, PNMA7A, SIZN, SIZN1, Validated applications: ICC, IHC, WB, Uniprot ID: Q6PEW1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZCCHC12
Gene Description zinc finger, CCHC domain containing 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence RLPNFLELIRMVREEEDWDDAFIKRKRPKRSESMVERAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILVESQDPPLPSWGA
Immunogen RLPNFLELIRMVREEEDWDDAFIKRKRPKRSESMVERAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILVESQDPPLPSWGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ16123, PNMA7A, SIZN, SIZN1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PEW1
HTS Code 3002150000
Gene ID 170261
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZCCHC12 Antibody 100ul

Anti-ZCCHC12 Antibody 100ul