BCL2L13,BCL-RAMBO
  • BCL2L13,BCL-RAMBO

Anti-BCL2L13 Antibody 100ul

Ref: AN-HPA030994-100ul
Anti-BCL2L13

Información del producto

Polyclonal Antibody against Human BCL2L13, Gene description: BCL2-like 13 (apoptosis facilitator), Alternative Gene Names: BCL-RAMBO, MIL1, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BXK5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BCL2L13
Gene Description BCL2-like 13 (apoptosis facilitator)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence QFGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPESPTVTTSWQSE
Immunogen QFGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPESPTVTTSWQSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BCL-RAMBO, MIL1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BXK5
HTS Code 3002150000
Gene ID 23786
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BCL2L13 Antibody 100ul

Anti-BCL2L13 Antibody 100ul