HDAC5,FLJ90614
  • HDAC5,FLJ90614

Anti-HDAC5 Antibody 25ul

Ref: AN-HPA030991-25ul
Anti-HDAC5

Información del producto

Polyclonal Antibody against Human HDAC5, Gene description: histone deacetylase 5, Alternative Gene Names: FLJ90614, KIAA0600, NY-CO-9, Validated applications: ICC, IHC, Uniprot ID: Q9UQL6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HDAC5
Gene Description histone deacetylase 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence THPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQP
Immunogen THPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ90614, KIAA0600, NY-CO-9
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UQL6
HTS Code 3002150000
Gene ID 10014
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HDAC5 Antibody 25ul

Anti-HDAC5 Antibody 25ul