PPM1F,CAMKP
  • PPM1F,CAMKP

Anti-PPM1F Antibody 25ul

Ref: AN-HPA030990-25ul
Anti-PPM1F

Información del producto

Polyclonal Antibody against Human PPM1F, Gene description: protein phosphatase, Mg2+/Mn2+ dependent, 1F, Alternative Gene Names: CAMKP, CaMKPase, FEM-2, KIAA0015, POPX2, Validated applications: IHC, WB, Uniprot ID: P49593, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PPM1F
Gene Description protein phosphatase, Mg2+/Mn2+ dependent, 1F
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQ
Immunogen VVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAMKP, CaMKPase, FEM-2, KIAA0015, POPX2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49593
HTS Code 3002150000
Gene ID 9647
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPM1F Antibody 25ul

Anti-PPM1F Antibody 25ul