MX1,IFI-78K,MxA
  • MX1,IFI-78K,MxA

Anti-MX1 Antibody 100ul

Ref: AN-HPA030917-100ul
Anti-MX1

Información del producto

Polyclonal Antibody against Human MX1, Gene description: MX dynamin-like GTPase 1, Alternative Gene Names: IFI-78K, MxA, Validated applications: IHC, WB, Uniprot ID: P20591, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MX1
Gene Description MX dynamin-like GTPase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence IEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSS
Immunogen IEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IFI-78K, MxA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P20591
HTS Code 3002150000
Gene ID 4599
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MX1 Antibody 100ul

Anti-MX1 Antibody 100ul