RBFOX3,FOX-3,HRNBP3
  • RBFOX3,FOX-3,HRNBP3

Anti-RBFOX3 Antibody 25ul

Ref: AN-HPA030790-25ul
Anti-RBFOX3

Información del producto

Polyclonal Antibody against Human RBFOX3, Gene description: RNA binding protein, fox-1 homolog (C. elegans) 3, Alternative Gene Names: FOX-3, HRNBP3, NeuN, Validated applications: ICC, IHC, Uniprot ID: A6NFN3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RBFOX3
Gene Description RNA binding protein, fox-1 homolog (C. elegans) 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQ
Immunogen PTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FOX-3, HRNBP3, NeuN
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A6NFN3
HTS Code 3002150000
Gene ID 146713
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RBFOX3 Antibody 25ul

Anti-RBFOX3 Antibody 25ul