MKL1,BSAC,KIAA1438
  • MKL1,BSAC,KIAA1438

Anti-MKL1 Antibody 25ul

Ref: AN-HPA030782-25ul
Anti-MKL1

Información del producto

Polyclonal Antibody against Human MKL1, Gene description: megakaryoblastic leukemia (translocation) 1, Alternative Gene Names: BSAC, KIAA1438, MAL, MRTF-A, Validated applications: ICC, IHC, WB, Uniprot ID: Q969V6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MKL1
Gene Description megakaryoblastic leukemia (translocation) 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG
Immunogen EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BSAC, KIAA1438, MAL, MRTF-A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969V6
HTS Code 3002150000
Gene ID 57591
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MKL1 Antibody 25ul

Anti-MKL1 Antibody 25ul