VDAC1,MGC111064
  • VDAC1,MGC111064

Anti-VDAC1 Antibody 25ul

Ref: AN-HPA030780-25ul
Anti-VDAC1

Información del producto

Polyclonal Antibody against Human VDAC1, Gene description: voltage-dependent anion channel 1, Alternative Gene Names: MGC111064, PORIN, Validated applications: IHC, WB, Uniprot ID: P21796, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VDAC1
Gene Description voltage-dependent anion channel 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence KWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVN
Immunogen KWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC111064, PORIN
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P21796
HTS Code 3002150000
Gene ID 7416
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VDAC1 Antibody 25ul

Anti-VDAC1 Antibody 25ul