OGT,FLJ23071,HRNT1
  • OGT,FLJ23071,HRNT1

Anti-OGT Antibody 25ul

Ref: AN-HPA030752-25ul
Anti-OGT

Información del producto

Polyclonal Antibody against Human OGT, Gene description: O-linked N-acetylglucosamine (GlcNAc) transferase, Alternative Gene Names: FLJ23071, HRNT1, MGC22921, O-GLCNAC, Validated applications: IHC, WB, Uniprot ID: O15294, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name OGT
Gene Description O-linked N-acetylglucosamine (GlcNAc) transferase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence NMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATT
Immunogen NMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ23071, HRNT1, MGC22921, O-GLCNAC
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15294
HTS Code 3002150000
Gene ID 8473
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-OGT Antibody 25ul

Anti-OGT Antibody 25ul