STT3A,ITM1,MGC9042
  • STT3A,ITM1,MGC9042

Anti-STT3A Antibody 25ul

Ref: AN-HPA030735-25ul
Anti-STT3A

Información del producto

Polyclonal Antibody against Human STT3A, Gene description: STT3A, subunit of the oligosaccharyltransferase complex (catalytic), Alternative Gene Names: ITM1, MGC9042, STT3-A, TMC, Validated applications: IHC, Uniprot ID: P46977, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name STT3A
Gene Description STT3A, subunit of the oligosaccharyltransferase complex (catalytic)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKR
Immunogen VRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ITM1, MGC9042, STT3-A, TMC
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P46977
HTS Code 3002150000
Gene ID 3703
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-STT3A Antibody 25ul

Anti-STT3A Antibody 25ul