ABTB2,ABTB2A,BTBD22
  • ABTB2,ABTB2A,BTBD22

Anti-ABTB2 Antibody 100ul

Ref: AN-HPA030699-100ul
Anti-ABTB2

Información del producto

Polyclonal Antibody against Human ABTB2, Gene description: ankyrin repeat and BTB (POZ) domain containing 2, Alternative Gene Names: ABTB2A, BTBD22, DKFZP586C1619, Validated applications: ICC, Uniprot ID: Q8N961, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ABTB2
Gene Description ankyrin repeat and BTB (POZ) domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MVDTRISVRIHEYAAISLTACMENLVEEIRARVMASHSPDGGGAGGGEVSAEALEMVINNDAELWGVLQPYEH
Immunogen MVDTRISVRIHEYAAISLTACMENLVEEIRARVMASHSPDGGGAGGGEVSAEALEMVINNDAELWGVLQPYEH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABTB2A, BTBD22, DKFZP586C1619
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N961
HTS Code 3002150000
Gene ID 25841
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ABTB2 Antibody 100ul

Anti-ABTB2 Antibody 100ul