RCN2,E6BP,ERC-55
  • RCN2,E6BP,ERC-55

Anti-RCN2 Antibody 25ul

Ref: AN-HPA030695-25ul
Anti-RCN2

Información del producto

Polyclonal Antibody against Human RCN2, Gene description: reticulocalbin 2, EF-hand calcium binding domain, Alternative Gene Names: E6BP, ERC-55, ERC55, TCBP49, Validated applications: ICC, IHC, WB, Uniprot ID: Q14257, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RCN2
Gene Description reticulocalbin 2, EF-hand calcium binding domain
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications ICC, IHC, WB
Sequence VTWDEYNIQMYDRVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEF
Immunogen VTWDEYNIQMYDRVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names E6BP, ERC-55, ERC55, TCBP49
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14257
HTS Code 3002150000
Gene ID 5955
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RCN2 Antibody 25ul

Anti-RCN2 Antibody 25ul