DSN1,C20orf172
  • DSN1,C20orf172

Anti-DSN1 Antibody 100ul

Ref: AN-HPA030627-100ul
Anti-DSN1

Información del producto

Polyclonal Antibody against Human DSN1, Gene description: DSN1 homolog, MIS12 kinetochore complex component, Alternative Gene Names: C20orf172, dJ469A13.2, hKNL-3, KNL3, MIS13, Validated applications: ICC, Uniprot ID: Q9H410, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DSN1
Gene Description DSN1 homolog, MIS12 kinetochore complex component
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LSHQERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQ
Immunogen LSHQERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf172, dJ469A13.2, hKNL-3, KNL3, MIS13
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H410
HTS Code 3002150000
Gene ID 79980
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DSN1 Antibody 100ul

Anti-DSN1 Antibody 100ul