CARMIL3,BC008134
  • CARMIL3,BC008134

Anti-CARMIL3 Antibody 100ul

Ref: AN-HPA030596-100ul
Anti-CARMIL3

Información del producto

Polyclonal Antibody against Human CARMIL3, Gene description: capping protein regulator and myosin 1 linker 3, Alternative Gene Names: BC008134, C14orf121, crml-1, LRRC16B, Validated applications: IHC, Uniprot ID: Q8ND23, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CARMIL3
Gene Description capping protein regulator and myosin 1 linker 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CDYNGLHCREEVQWDVDTIYHAEDNREFNLLDFSHLESRDLALMVAALAYNQWFTKLYCKDLRLGSEVLEQVLHTLSKSGSLEELVLDNAGLKTDFVQKLAGVFGENGSCVLHALTL
Immunogen CDYNGLHCREEVQWDVDTIYHAEDNREFNLLDFSHLESRDLALMVAALAYNQWFTKLYCKDLRLGSEVLEQVLHTLSKSGSLEELVLDNAGLKTDFVQKLAGVFGENGSCVLHALTL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BC008134, C14orf121, crml-1, LRRC16B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8ND23
HTS Code 3002150000
Gene ID 90668
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CARMIL3 Antibody 100ul

Anti-CARMIL3 Antibody 100ul