IL22RA2,CRF2-S1
  • IL22RA2,CRF2-S1

Anti-IL22RA2 Antibody 25ul

Ref: AN-HPA030582-25ul
Anti-IL22RA2

Información del producto

Polyclonal Antibody against Human IL22RA2, Gene description: interleukin 22 receptor, alpha 2, Alternative Gene Names: CRF2-S1, IL-22BP, Validated applications: IHC, WB, Uniprot ID: Q969J5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IL22RA2
Gene Description interleukin 22 receptor, alpha 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
Immunogen PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CRF2-S1, IL-22BP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969J5
HTS Code 3002150000
Gene ID 116379
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IL22RA2 Antibody 25ul

Anti-IL22RA2 Antibody 25ul