SMAP1,FLJ13159
  • SMAP1,FLJ13159

Anti-SMAP1 Antibody 25ul

Ref: AN-HPA030574-25ul
Anti-SMAP1

Información del producto

Polyclonal Antibody against Human SMAP1, Gene description: small ArfGAP 1, Alternative Gene Names: FLJ13159, SMAP-1, Validated applications: ICC, IHC, WB, Uniprot ID: Q8IYB5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SMAP1
Gene Description small ArfGAP 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence KAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSIL
Immunogen KAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSIL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13159, SMAP-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IYB5
HTS Code 3002150000
Gene ID 60682
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SMAP1 Antibody 25ul

Anti-SMAP1 Antibody 25ul