TSR2,DT1P1A10
  • TSR2,DT1P1A10

Anti-TSR2 Antibody 25ul

Ref: AN-HPA030514-25ul
Anti-TSR2

Información del producto

Polyclonal Antibody against Human TSR2, Gene description: TSR2, 20S rRNA accumulation, homolog (S. cerevisiae), Alternative Gene Names: DT1P1A10, RP1-112K5.2, WGG1, Validated applications: ICC, IHC, WB, Uniprot ID: Q969E8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TSR2
Gene Description TSR2, 20S rRNA accumulation, homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence AVENGFGGVHSQEKAKWLGGAVEDYFMRNADLELDEVEDFLGELLTNEFDTVVEDGSLPQVSQQLQTMFHHFQRGDGAALREMASCITQRKCKVTATALKTARETDEDEDDVDSVEEMEVT
Immunogen AVENGFGGVHSQEKAKWLGGAVEDYFMRNADLELDEVEDFLGELLTNEFDTVVEDGSLPQVSQQLQTMFHHFQRGDGAALREMASCITQRKCKVTATALKTARETDEDEDDVDSVEEMEVT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DT1P1A10, RP1-112K5.2, WGG1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969E8
HTS Code 3002150000
Gene ID 90121
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSR2 Antibody 25ul

Anti-TSR2 Antibody 25ul