MRPS33,CGI-139
  • MRPS33,CGI-139

Anti-MRPS33 Antibody 100ul

Ref: AN-HPA030425-100ul
Anti-MRPS33

Información del producto

Polyclonal Antibody against Human MRPS33, Gene description: mitochondrial ribosomal protein S33, Alternative Gene Names: CGI-139, Validated applications: IHC, Uniprot ID: Q9Y291, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPS33
Gene Description mitochondrial ribosomal protein S33
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYR
Immunogen MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-139
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y291
HTS Code 3002150000
Gene ID 51650
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPS33 Antibody 100ul

Anti-MRPS33 Antibody 100ul