KCMF1,DEBT91
  • KCMF1,DEBT91

Anti-KCMF1 Antibody 100ul

Ref: AN-HPA030384-100ul
Anti-KCMF1

Información del producto

Polyclonal Antibody against Human KCMF1, Gene description: potassium channel modulatory factor 1, Alternative Gene Names: DEBT91, DKFZP434L1021, PCMF, ZZZ1, Validated applications: ICC, IHC, WB, Uniprot ID: Q9P0J7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KCMF1
Gene Description potassium channel modulatory factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence MSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAMGCVDIMPLDVALENLNLKESNKGNEPPPPPL
Immunogen MSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAMGCVDIMPLDVALENLNLKESNKGNEPPPPPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DEBT91, DKFZP434L1021, PCMF, ZZZ1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P0J7
HTS Code 3002150000
Gene ID 56888
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KCMF1 Antibody 100ul

Anti-KCMF1 Antibody 100ul