CCL14,CKb1,HCC-1
  • CCL14,CKb1,HCC-1

Anti-CCL14 Antibody 100ul

Ref: AN-HPA030268-100ul
Anti-CCL14

Información del producto

Polyclonal Antibody against Human CCL14, Gene description: chemokine (C-C motif) ligand 14, Alternative Gene Names: CKb1, HCC-1, HCC-3, MCIF, NCC-2, SCYA14, SCYL2, Validated applications: IHC, Uniprot ID: Q16627, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCL14
Gene Description chemokine (C-C motif) ligand 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKE
Immunogen TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CKb1, HCC-1, HCC-3, MCIF, NCC-2, SCYA14, SCYL2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16627
HTS Code 3002150000
Gene ID 6358
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCL14 Antibody 100ul

Anti-CCL14 Antibody 100ul