USP49,MGC20741
  • USP49,MGC20741

Anti-USP49 Antibody 25ul

Ref: AN-HPA030255-25ul
Anti-USP49

Información del producto

Polyclonal Antibody against Human USP49, Gene description: ubiquitin specific peptidase 49, Alternative Gene Names: MGC20741, Validated applications: IHC, WB, Uniprot ID: Q70CQ1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name USP49
Gene Description ubiquitin specific peptidase 49
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence ECFLNLDPSKTEHLFPKATNGKTQLSGKPTNSSATELSLRNDRAEACEREGFCWNGRASISRSLELIQNKEPSSK
Immunogen ECFLNLDPSKTEHLFPKATNGKTQLSGKPTNSSATELSLRNDRAEACEREGFCWNGRASISRSLELIQNKEPSSK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC20741
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q70CQ1
HTS Code 3002150000
Gene ID 25862
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-USP49 Antibody 25ul

Anti-USP49 Antibody 25ul