HOPX,HOP,LAGY,NECC1
  • HOPX,HOP,LAGY,NECC1

Anti-HOPX Antibody 25ul

Ref: AN-HPA030180-25ul
Anti-HOPX

Información del producto

Polyclonal Antibody against Human HOPX, Gene description: HOP homeobox, Alternative Gene Names: HOP, LAGY, NECC1, OB1, SMAP31, Validated applications: IHC, Uniprot ID: Q9BPY8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HOPX
Gene Description HOP homeobox
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
Immunogen MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HOP, LAGY, NECC1, OB1, SMAP31
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BPY8
HTS Code 3002150000
Gene ID 84525
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HOPX Antibody 25ul

Anti-HOPX Antibody 25ul