GALNT14,FLJ12691
  • GALNT14,FLJ12691

Anti-GALNT14 Antibody 100ul

Ref: AN-HPA030138-100ul
Anti-GALNT14

Información del producto

Polyclonal Antibody against Human GALNT14, Gene description: polypeptide N-acetylgalactosaminyltransferase 14, Alternative Gene Names: FLJ12691, GalNac-T10, GalNac-T14, Validated applications: ICC, Uniprot ID: Q96FL9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GALNT14
Gene Description polypeptide N-acetylgalactosaminyltransferase 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IREIILVDDFSNDPDDCKQLIKLPKVKCLRNNERQGLVRSRIRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYTRVVCPVIDIINLDTFTYIESASELRGGFDWSLHFQWEQL
Immunogen IREIILVDDFSNDPDDCKQLIKLPKVKCLRNNERQGLVRSRIRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYTRVVCPVIDIINLDTFTYIESASELRGGFDWSLHFQWEQL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ12691, GalNac-T10, GalNac-T14
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96FL9
HTS Code 3002150000
Gene ID 79623
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GALNT14 Antibody 100ul

Anti-GALNT14 Antibody 100ul