PAK1IP1,bA421M1.5
  • PAK1IP1,bA421M1.5

Anti-PAK1IP1 Antibody 25ul

Ref: AN-HPA030112-25ul
Anti-PAK1IP1

Información del producto

Polyclonal Antibody against Human PAK1IP1, Gene description: PAK1 interacting protein 1, Alternative Gene Names: bA421M1.5, FLJ20624, hPIP1, MAK11, PIP1, WDR84, Validated applications: IHC, WB, Uniprot ID: Q9NWT1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PAK1IP1
Gene Description PAK1 interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTKKRGLTGDSKKATKES
Immunogen VWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTKKRGLTGDSKKATKES
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA421M1.5, FLJ20624, hPIP1, MAK11, PIP1, WDR84
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NWT1
HTS Code 3002150000
Gene ID 55003
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PAK1IP1 Antibody 25ul

Anti-PAK1IP1 Antibody 25ul