FAM136A,FLJ14668
  • FAM136A,FLJ14668

Anti-FAM136A Antibody 100ul

Ref: AN-HPA030104-100ul
Anti-FAM136A

Información del producto

Polyclonal Antibody against Human FAM136A, Gene description: family with sequence similarity 136, member A, Alternative Gene Names: FLJ14668, Validated applications: ICC, IHC, WB, Uniprot ID: Q96C01, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM136A
Gene Description family with sequence similarity 136, member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVT
Immunogen MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ14668
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96C01
HTS Code 3002150000
Gene ID 84908
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM136A Antibody 100ul

Anti-FAM136A Antibody 100ul