FOXM1,FKHL16,HFH-11
  • FOXM1,FKHL16,HFH-11

Anti-FOXM1 Antibody 100ul

Ref: AN-HPA029974-100ul
Anti-FOXM1

Información del producto

Polyclonal Antibody against Human FOXM1, Gene description: forkhead box M1, Alternative Gene Names: FKHL16, HFH-11, HNF-3, INS-1, MPHOSPH2, MPP2, TGT3, trident, Validated applications: IHC, Uniprot ID: Q08050, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FOXM1
Gene Description forkhead box M1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL
Immunogen GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FKHL16, HFH-11, HNF-3, INS-1, MPHOSPH2, MPP2, TGT3, trident
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q08050
HTS Code 3002150000
Gene ID 2305
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FOXM1 Antibody 100ul

Anti-FOXM1 Antibody 100ul