TSACC,C1orf182,SIP
  • TSACC,C1orf182,SIP

Anti-TSACC Antibody 25ul

Ref: AN-HPA029897-25ul
Anti-TSACC

Información del producto

Polyclonal Antibody against Human TSACC, Gene description: TSSK6 activating co-chaperone, Alternative Gene Names: C1orf182, SIP, SSTK-IP, Validated applications: ICC, WB, Uniprot ID: Q96A04, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TSACC
Gene Description TSSK6 activating co-chaperone
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLG
Immunogen MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf182, SIP, SSTK-IP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96A04
HTS Code 3002150000
Gene ID 128229
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSACC Antibody 25ul

Anti-TSACC Antibody 25ul