SCUBE2,Cegb1,Cegf1
  • SCUBE2,Cegb1,Cegf1

Anti-SCUBE2 Antibody 100ul

Ref: AN-HPA029871-100ul
Anti-SCUBE2

Información del producto

Polyclonal Antibody against Human SCUBE2, Gene description: signal peptide, CUB domain, EGF-like 2, Alternative Gene Names: Cegb1, Cegf1, FLJ16792, Validated applications: IHC, Uniprot ID: Q9NQ36, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SCUBE2
Gene Description signal peptide, CUB domain, EGF-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SGIHLSSDVTTIRTSVTFKLNEGKCSLKNAELFPEGLRPALPEKHSSVKESFRYVNLTCSSGKQVPGAPGRPSTPKEMFITVEFELETNQKEVTASCDLSCIVKRTEKRLRKAIRTLRKAVHREQFHLQLSGMNLDVAK
Immunogen SGIHLSSDVTTIRTSVTFKLNEGKCSLKNAELFPEGLRPALPEKHSSVKESFRYVNLTCSSGKQVPGAPGRPSTPKEMFITVEFELETNQKEVTASCDLSCIVKRTEKRLRKAIRTLRKAVHREQFHLQLSGMNLDVAK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Cegb1, Cegf1, FLJ16792
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQ36
HTS Code 3002150000
Gene ID 57758
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SCUBE2 Antibody 100ul

Anti-SCUBE2 Antibody 100ul