NDUFA1,CI-MWFE,MWFE
  • NDUFA1,CI-MWFE,MWFE

Anti-NDUFA1 Antibody 100ul

Ref: AN-HPA029768-100ul
Anti-NDUFA1

Información del producto

Polyclonal Antibody against Human NDUFA1, Gene description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa, Alternative Gene Names: CI-MWFE, MWFE, Validated applications: ICC, Uniprot ID: O15239, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NDUFA1
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence HRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKG
Immunogen HRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CI-MWFE, MWFE
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15239
HTS Code 3002150000
Gene ID 4694
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NDUFA1 Antibody 100ul

Anti-NDUFA1 Antibody 100ul