GPR132,G2A
  • GPR132,G2A

Anti-GPR132 Antibody 100ul

Ref: AN-HPA029694-100ul
Anti-GPR132

Información del producto

Polyclonal Antibody against Human GPR132, Gene description: G protein-coupled receptor 132, Alternative Gene Names: G2A, Validated applications: IHC, Uniprot ID: Q9UNW8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GPR132
Gene Description G protein-coupled receptor 132
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEE
Immunogen HSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names G2A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UNW8
HTS Code 3002150000
Gene ID 29933
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GPR132 Antibody 100ul

Anti-GPR132 Antibody 100ul