CCDC47,GK001
  • CCDC47,GK001

Anti-CCDC47 Antibody 100ul

Ref: AN-HPA029674-100ul
Anti-CCDC47

Información del producto

Polyclonal Antibody against Human CCDC47, Gene description: coiled-coil domain containing 47, Alternative Gene Names: GK001, Validated applications: ICC, IHC, WB, Uniprot ID: Q96A33, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC47
Gene Description coiled-coil domain containing 47
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence YADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRR
Immunogen YADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GK001
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96A33
HTS Code 3002150000
Gene ID 57003
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCDC47 Antibody 100ul

Anti-CCDC47 Antibody 100ul