SNAP91,AP180,CALM
  • SNAP91,AP180,CALM

Anti-SNAP91 Antibody 100ul

Ref: AN-HPA029632-100ul
Anti-SNAP91

Información del producto

Polyclonal Antibody against Human SNAP91, Gene description: synaptosomal-associated protein, 91kDa, Alternative Gene Names: AP180, CALM, KIAA0656, Validated applications: IHC, Uniprot ID: O60641, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SNAP91
Gene Description synaptosomal-associated protein, 91kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LMETLEQHLNTLEGKKPGNNEGSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLLDLQPDFSSGGAAAAAAPAPPPPA
Immunogen LMETLEQHLNTLEGKKPGNNEGSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLLDLQPDFSSGGAAAAAAPAPPPPA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP180, CALM, KIAA0656
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60641
HTS Code 3002150000
Gene ID 9892
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SNAP91 Antibody 100ul

Anti-SNAP91 Antibody 100ul