EFCAB7,KIAA1799
  • EFCAB7,KIAA1799

Anti-EFCAB7 Antibody 25ul

Ref: AN-HPA029612-25ul
Anti-EFCAB7

Información del producto

Polyclonal Antibody against Human EFCAB7, Gene description: EF-hand calcium binding domain 7, Alternative Gene Names: KIAA1799, RP4-534K7.1, Validated applications: IHC, Uniprot ID: A8K855, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EFCAB7
Gene Description EF-hand calcium binding domain 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence WTGELGPGIYWLIPSTTGCRLRKKIKPVTDEAQLVYRDETGELFLTKEFKSTLSDIFEVIDLDGNGLLSLEEYNFFELRTSGEKCDEDAWAVC
Immunogen WTGELGPGIYWLIPSTTGCRLRKKIKPVTDEAQLVYRDETGELFLTKEFKSTLSDIFEVIDLDGNGLLSLEEYNFFELRTSGEKCDEDAWAVC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1799, RP4-534K7.1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A8K855
HTS Code 3002150000
Gene ID 84455
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EFCAB7 Antibody 25ul

Anti-EFCAB7 Antibody 25ul