RNF217,C6orf172
  • RNF217,C6orf172

Anti-RNF217 Antibody 100ul

Ref: AN-HPA029598-100ul
Anti-RNF217

Información del producto

Polyclonal Antibody against Human RNF217, Gene description: ring finger protein 217, Alternative Gene Names: C6orf172, dJ84N20.1, IBRDC1, MGC26996, Validated applications: IHC, WB, Uniprot ID: Q8TC41, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RNF217
Gene Description ring finger protein 217
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence GQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKK
Immunogen GQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf172, dJ84N20.1, IBRDC1, MGC26996
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TC41
HTS Code 3002150000
Gene ID 154214
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RNF217 Antibody 100ul

Anti-RNF217 Antibody 100ul