CRYZL1,4P11,QOH-1
  • CRYZL1,4P11,QOH-1

Anti-CRYZL1 Antibody 100ul

Ref: AN-HPA029399-100ul
Anti-CRYZL1

Información del producto

Polyclonal Antibody against Human CRYZL1, Gene description: crystallin, zeta (quinone reductase)-like 1, Alternative Gene Names: 4P11, QOH-1, Validated applications: IHC, WB, Uniprot ID: O95825, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CRYZL1
Gene Description crystallin, zeta (quinone reductase)-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence VGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLSHLSPGKSVLIMDGASAFGTI
Immunogen VGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLSHLSPGKSVLIMDGASAFGTI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 4P11, QOH-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95825
HTS Code 3002150000
Gene ID 9946
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CRYZL1 Antibody 100ul

Anti-CRYZL1 Antibody 100ul