GAPVD1,DKFZP434C212
  • GAPVD1,DKFZP434C212

Anti-GAPVD1 Antibody 25ul

Ref: AN-HPA029387-25ul
Anti-GAPVD1

Información del producto

Polyclonal Antibody against Human GAPVD1, Gene description: GTPase activating protein and VPS9 domains 1, Alternative Gene Names: DKFZP434C212, KIAA1521, Validated applications: ICC, IHC, Uniprot ID: Q14C86, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GAPVD1
Gene Description GTPase activating protein and VPS9 domains 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence AMTGSEEGDPRTKSSLGKFDKSCVAAFLDVVIGGRAVETPPLSSVNLLEGLSRTVVYITYSQLITLVNFMKSVMSGDQLREDRMALDNLLANLP
Immunogen AMTGSEEGDPRTKSSLGKFDKSCVAAFLDVVIGGRAVETPPLSSVNLLEGLSRTVVYITYSQLITLVNFMKSVMSGDQLREDRMALDNLLANLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434C212, KIAA1521
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14C86
HTS Code 3002150000
Gene ID 26130
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GAPVD1 Antibody 25ul

Anti-GAPVD1 Antibody 25ul