MS4A4A,CD20L1,MS4A4
  • MS4A4A,CD20L1,MS4A4

Anti-MS4A4A Antibody 25ul

Ref: AN-HPA029323-25ul
Anti-MS4A4A

Información del producto

Polyclonal Antibody against Human MS4A4A, Gene description: membrane-spanning 4-domains, subfamily A, member 4A, Alternative Gene Names: CD20L1, MS4A4, MS4A7, Validated applications: IHC, Uniprot ID: Q96JQ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MS4A4A
Gene Description membrane-spanning 4-domains, subfamily A, member 4A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SAFGCKVLCCTPGGVVLILPSHSHMAETASPTPLNEV
Immunogen SAFGCKVLCCTPGGVVLILPSHSHMAETASPTPLNEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD20L1, MS4A4, MS4A7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96JQ5
HTS Code 3002150000
Gene ID 51338
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MS4A4A Antibody 25ul

Anti-MS4A4A Antibody 25ul