SNRNP200,ASCC3L1
  • SNRNP200,ASCC3L1

Anti-SNRNP200 Antibody 25ul

Ref: AN-HPA029321-25ul
Anti-SNRNP200

Información del producto

Polyclonal Antibody against Human SNRNP200, Gene description: small nuclear ribonucleoprotein 200kDa (U5), Alternative Gene Names: ASCC3L1, BRR2, HELIC2, KIAA0788, RP33, U5-200KD, Validated applications: ICC, IHC, Uniprot ID: O75643, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SNRNP200
Gene Description small nuclear ribonucleoprotein 200kDa (U5)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLY
Immunogen LHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ASCC3L1, BRR2, HELIC2, KIAA0788, RP33, U5-200KD
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75643
HTS Code 3002150000
Gene ID 23020
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SNRNP200 Antibody 25ul

Anti-SNRNP200 Antibody 25ul