TSEN15,C1orf19
  • TSEN15,C1orf19

Anti-TSEN15 Antibody 100ul

Ref: AN-HPA029237-100ul
Anti-TSEN15

Información del producto

Polyclonal Antibody against Human TSEN15, Gene description: TSEN15 tRNA splicing endonuclease subunit, Alternative Gene Names: C1orf19, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WW01, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSEN15
Gene Description TSEN15 tRNA splicing endonuclease subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence EERGDSEPTPGCSGLGPDGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATHVYVAFLVYLDLMESK
Immunogen EERGDSEPTPGCSGLGPDGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATHVYVAFLVYLDLMESK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf19
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WW01
HTS Code 3002150000
Gene ID 116461
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSEN15 Antibody 100ul

Anti-TSEN15 Antibody 100ul