GZMH,CCP-X,CGL-2
  • GZMH,CCP-X,CGL-2

Anti-GZMH Antibody 100ul

Ref: AN-HPA029200-100ul
Anti-GZMH

Información del producto

Polyclonal Antibody against Human GZMH, Gene description: granzyme H (cathepsin G-like 2, protein h-CCPX), Alternative Gene Names: CCP-X, CGL-2, CSP-C, CTLA1, CTSGL2, Validated applications: IHC, WB, Uniprot ID: P20718, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GZMH
Gene Description granzyme H (cathepsin G-like 2, protein h-CCPX)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence HPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTM
Immunogen HPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CCP-X, CGL-2, CSP-C, CTLA1, CTSGL2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P20718
HTS Code 3002150000
Gene ID 2999
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GZMH Antibody 100ul

Anti-GZMH Antibody 100ul