SNU13,15.5K,FA-1
  • SNU13,15.5K,FA-1

Anti-SNU13 Antibody 25ul

Ref: AN-HPA029199-25ul
Anti-SNU13

Información del producto

Polyclonal Antibody against Human SNU13, Gene description: SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5), Alternative Gene Names: 15.5K, FA-1, NHP2L1, SNRNP15-5, SPAG12, SSFA1, Validated applications: IHC, WB, Uniprot ID: P55769, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SNU13
Gene Description SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERL
Immunogen TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 15.5K, FA-1, NHP2L1, SNRNP15-5, SPAG12, SSFA1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55769
HTS Code 3002150000
Gene ID 4809
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SNU13 Antibody 25ul

Anti-SNU13 Antibody 25ul