CTNNB1,armadillo
  • CTNNB1,armadillo

Anti-CTNNB1 Antibody 25ul

Ref: AN-HPA029159-25ul
Anti-CTNNB1

Información del producto

Polyclonal Antibody against Human CTNNB1, Gene description: catenin (cadherin-associated protein), beta 1, 88kDa, Alternative Gene Names: armadillo, beta-catenin, CTNNB, Validated applications: ICC, IHC, WB, Uniprot ID: P35222, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CTNNB1
Gene Description catenin (cadherin-associated protein), beta 1, 88kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
Immunogen SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names armadillo, beta-catenin, CTNNB
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35222
HTS Code 3002150000
Gene ID 1499
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CTNNB1 Antibody 25ul

Anti-CTNNB1 Antibody 25ul