FPR2,ALXR,FMLP-R-II
  • FPR2,ALXR,FMLP-R-II

Anti-FPR2 Antibody 25ul

Ref: AN-HPA029154-25ul
Anti-FPR2

Información del producto

Polyclonal Antibody against Human FPR2, Gene description: formyl peptide receptor 2, Alternative Gene Names: ALXR, FMLP-R-II, FMLPX, FPR2A, FPRH2, FPRL1, HM63, LXA4R, Validated applications: IHC, Uniprot ID: P25090, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FPR2
Gene Description formyl peptide receptor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DTYCTFNFASWGGTPEERLKVAITMLTARG
Immunogen DTYCTFNFASWGGTPEERLKVAITMLTARG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALXR, FMLP-R-II, FMLPX, FPR2A, FPRH2, FPRL1, HM63, LXA4R
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P25090
HTS Code 3002150000
Gene ID 2358
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FPR2 Antibody 25ul

Anti-FPR2 Antibody 25ul