CEP85L,bA57K17.2
  • CEP85L,bA57K17.2

Anti-CEP85L Antibody 100ul

Ref: AN-HPA029137-100ul
Anti-CEP85L

Información del producto

Polyclonal Antibody against Human CEP85L, Gene description: centrosomal protein 85kDa-like, Alternative Gene Names: bA57K17.2, C6orf204, NY-BR-15, Validated applications: IHC, WB, Uniprot ID: Q5SZL2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CEP85L
Gene Description centrosomal protein 85kDa-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSYSPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQ
Immunogen EDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSYSPGYQDFSKWESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA57K17.2, C6orf204, NY-BR-15
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SZL2
HTS Code 3002150000
Gene ID 387119
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CEP85L Antibody 100ul

Anti-CEP85L Antibody 100ul