LAMP2,CD107b
  • LAMP2,CD107b

Anti-LAMP2 Antibody 25ul

Ref: AN-HPA029100-25ul
Anti-LAMP2

Información del producto

Polyclonal Antibody against Human LAMP2, Gene description: lysosomal-associated membrane protein 2, Alternative Gene Names: CD107b, Validated applications: IHC, WB, Uniprot ID: P13473, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LAMP2
Gene Description lysosomal-associated membrane protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLV
Immunogen ASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD107b
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P13473
HTS Code 3002150000
Gene ID 3920
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LAMP2 Antibody 25ul

Anti-LAMP2 Antibody 25ul