MAPKAP1,MGC2745
  • MAPKAP1,MGC2745

Anti-MAPKAP1 Antibody 100ul

Ref: AN-HPA029092-100ul
Anti-MAPKAP1

Información del producto

Polyclonal Antibody against Human MAPKAP1, Gene description: mitogen-activated protein kinase associated protein 1, Alternative Gene Names: MGC2745, MIP1, SIN1, Validated applications: IHC, WB, Uniprot ID: Q9BPZ7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAPKAP1
Gene Description mitogen-activated protein kinase associated protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence NPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKE
Immunogen NPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC2745, MIP1, SIN1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BPZ7
HTS Code 3002150000
Gene ID 79109
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MAPKAP1 Antibody 100ul

Anti-MAPKAP1 Antibody 100ul