LCA5,C6orf152
  • LCA5,C6orf152

Anti-LCA5 Antibody 25ul

Ref: AN-HPA029055-25ul
Anti-LCA5

Información del producto

Polyclonal Antibody against Human LCA5, Gene description: Leber congenital amaurosis 5, Alternative Gene Names: C6orf152, Validated applications: IHC, Uniprot ID: Q86VQ0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LCA5
Gene Description Leber congenital amaurosis 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NSGNVRSPASPNEFAFGSYVPSFAKTSERSNPFSQKSSFLDFQRNSMEKLSKDGVDLITRKEKKANLMEQLFGASG
Immunogen NSGNVRSPASPNEFAFGSYVPSFAKTSERSNPFSQKSSFLDFQRNSMEKLSKDGVDLITRKEKKANLMEQLFGASG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf152
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86VQ0
HTS Code 3002150000
Gene ID 167691
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LCA5 Antibody 25ul

Anti-LCA5 Antibody 25ul