ETV7,TEL-2,TEL2
  • ETV7,TEL-2,TEL2

Anti-ETV7 Antibody 25ul

Ref: AN-HPA029033-25ul
Anti-ETV7

Información del producto

Polyclonal Antibody against Human ETV7, Gene description: ets variant 7, Alternative Gene Names: TEL-2, TEL2, Validated applications: ICC, WB, Uniprot ID: Q9Y603, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ETV7
Gene Description ets variant 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence LLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIK
Immunogen LLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TEL-2, TEL2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y603
HTS Code 3002150000
Gene ID 51513
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ETV7 Antibody 25ul

Anti-ETV7 Antibody 25ul