KHDC1,bA257K9.4
  • KHDC1,bA257K9.4

Anti-KHDC1 Antibody 100ul

Ref: AN-HPA029032-100ul
Anti-KHDC1

Información del producto

Polyclonal Antibody against Human KHDC1, Gene description: KH homology domain containing 1, Alternative Gene Names: bA257K9.4, C6orf147, C6orf148, Em:AC019205.8, MGC10818, NDG1, Validated applications: ICC, Uniprot ID: Q4VXA5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KHDC1
Gene Description KH homology domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RERNSRSGKTRCRSKRSEQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGD
Immunogen RERNSRSGKTRCRSKRSEQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA257K9.4, C6orf147, C6orf148, Em:AC019205.8, MGC10818, NDG1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4VXA5
HTS Code 3002150000
Gene ID 80759
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KHDC1 Antibody 100ul

Anti-KHDC1 Antibody 100ul