EGR4,NGFI-C,PAT133
  • EGR4,NGFI-C,PAT133

Anti-EGR4 Antibody 100ul

Ref: AN-HPA028983-100ul
Anti-EGR4

Información del producto

Polyclonal Antibody against Human EGR4, Gene description: early growth response 4, Alternative Gene Names: NGFI-C, PAT133, Validated applications: IHC, Uniprot ID: Q05215, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EGR4
Gene Description early growth response 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLRSAAAADFPKPL
Immunogen PWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLRSAAAADFPKPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NGFI-C, PAT133
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q05215
HTS Code 3002150000
Gene ID 1961
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EGR4 Antibody 100ul

Anti-EGR4 Antibody 100ul